Lineage for d1v97b3 (1v97 B:537-694)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2944850Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2944851Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) (S)
  5. 2944852Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins)
  6. 2944914Protein Xanthine oxidase, domain 5 (?) [54670] (1 species)
  7. 2944915Species Cow (Bos taurus) [TaxId:9913] [54671] (11 PDB entries)
    Uniprot P80457
  8. 2944917Domain d1v97b3: 1v97 B:537-694 [108444]
    Other proteins in same PDB: d1v97a1, d1v97a2, d1v97a4, d1v97a5, d1v97a6, d1v97b1, d1v97b2, d1v97b4, d1v97b5, d1v97b6
    complexed with acy, ca, fad, fes, fyx, gol, mos, mte

Details for d1v97b3

PDB Entry: 1v97 (more details), 1.94 Å

PDB Description: Crystal Structure of Bovine Milk Xanthine Dehydrogenase FYX-051 bound form
PDB Compounds: (B:) Xanthine Dehydrogenase

SCOPe Domain Sequences for d1v97b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v97b3 d.41.1.1 (B:537-694) Xanthine oxidase, domain 5 (?) {Cow (Bos taurus) [TaxId: 9913]}
kldptytsatllfqkhppaniqlfqevpngqskedtvgrplphlaaamqasgeavycddi
pryenelflrlvtstrahakiksidvseaqkvpgfvcflsaddipgsnetglfndetvfa
kdtvtcvghiigavvadtpehaeraahvvkvtyedlpa

SCOPe Domain Coordinates for d1v97b3:

Click to download the PDB-style file with coordinates for d1v97b3.
(The format of our PDB-style files is described here.)

Timeline for d1v97b3: