Lineage for d1v97b2 (1v97 B:3-92)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. Protein Xanthine oxidase, N-terminal domain [54318] (1 species)
  7. Species Cow (Bos taurus) [TaxId:9913] [54319] (11 PDB entries)
    Uniprot P80457
  8. Domain d1v97b2: 1v97 B:3-92 [108443]
    Other proteins in same PDB: d1v97a1, d1v97a3, d1v97a4, d1v97a5, d1v97a6, d1v97b1, d1v97b3, d1v97b4, d1v97b5, d1v97b6
    complexed with acy, ca, fad, fes, fyx, gol, mos, mte

Details for d1v97b2

PDB Entry: 1v97 (more details), 1.94 Å

PDB Description: Crystal Structure of Bovine Milk Xanthine Dehydrogenase FYX-051 bound form
PDB Compounds: (B:) Xanthine Dehydrogenase

SCOPe Domain Sequences for d1v97b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v97b2 d.15.4.2 (B:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
adelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrlq
dkiihfsanaclapictlhhvavttvegig

SCOPe Domain Coordinates for d1v97b2 are not available.

Timeline for d1v97b2:

Domains from same chain:
(mouse over for more information)
d1v97b1, d1v97b3, d1v97b4, d1v97b5, d1v97b6
Domains from other chains:
(mouse over for more information)
d1v97a1, d1v97a2, d1v97a3, d1v97a4, d1v97a5, d1v97a6