Lineage for d1v97b1 (1v97 B:93-165)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 444152Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 444153Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family) (S)
    contains 2Fe-2S cluster
  5. 444154Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (5 proteins)
  6. 444192Protein Xanthine oxidase, domain 2 [47746] (1 species)
  7. 444193Species Cow (Bos taurus) [TaxId:9913] [47747] (4 PDB entries)
  8. 444195Domain d1v97b1: 1v97 B:93-165 [108442]
    Other proteins in same PDB: d1v97a2, d1v97a3, d1v97a4, d1v97a5, d1v97a6, d1v97b2, d1v97b3, d1v97b4, d1v97b5, d1v97b6

Details for d1v97b1

PDB Entry: 1v97 (more details), 1.94 Å

PDB Description: Crystal Structure of Bovine Milk Xanthine Dehydrogenase FYX-051 bound form

SCOP Domain Sequences for d1v97b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v97b1 a.56.1.1 (B:93-165) Xanthine oxidase, domain 2 {Cow (Bos taurus)}
stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg
yrpilqgfrtfak

SCOP Domain Coordinates for d1v97b1:

Click to download the PDB-style file with coordinates for d1v97b1.
(The format of our PDB-style files is described here.)

Timeline for d1v97b1: