Lineage for d1v97b1 (1v97 B:93-165)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715250Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 2715251Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 2715252Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)
  6. 2715311Protein Xanthine oxidase, domain 2 [47746] (1 species)
  7. 2715312Species Cow (Bos taurus) [TaxId:9913] [47747] (11 PDB entries)
    Uniprot P80457
  8. 2715314Domain d1v97b1: 1v97 B:93-165 [108442]
    Other proteins in same PDB: d1v97a2, d1v97a3, d1v97a4, d1v97a5, d1v97a6, d1v97b2, d1v97b3, d1v97b4, d1v97b5, d1v97b6
    complexed with acy, ca, fad, fes, fyx, gol, mos, mte

Details for d1v97b1

PDB Entry: 1v97 (more details), 1.94 Å

PDB Description: Crystal Structure of Bovine Milk Xanthine Dehydrogenase FYX-051 bound form
PDB Compounds: (B:) Xanthine Dehydrogenase

SCOPe Domain Sequences for d1v97b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v97b1 a.56.1.1 (B:93-165) Xanthine oxidase, domain 2 {Cow (Bos taurus) [TaxId: 9913]}
stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg
yrpilqgfrtfak

SCOPe Domain Coordinates for d1v97b1:

Click to download the PDB-style file with coordinates for d1v97b1.
(The format of our PDB-style files is described here.)

Timeline for d1v97b1: