Lineage for d1v97a6 (1v97 A:192-414)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 512542Fold d.145: FAD-binding domain [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 512543Superfamily d.145.1: FAD-binding domain [56176] (3 families) (S)
  5. 512608Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (4 proteins)
  6. 512640Protein Xanthine oxidase, domain 3 (?) [56191] (1 species)
  7. 512641Species Cow (Bos taurus) [TaxId:9913] [56192] (4 PDB entries)
  8. 512642Domain d1v97a6: 1v97 A:192-414 [108441]
    Other proteins in same PDB: d1v97a1, d1v97a2, d1v97a3, d1v97a4, d1v97a5, d1v97b1, d1v97b2, d1v97b3, d1v97b4, d1v97b5

Details for d1v97a6

PDB Entry: 1v97 (more details), 1.94 Å

PDB Description: Crystal Structure of Bovine Milk Xanthine Dehydrogenase FYX-051 bound form
PDB Compounds: (A:)

SCOP Domain Sequences for d1v97a6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v97a6 d.145.1.3 (A:192-414) Xanthine oxidase, domain 3 (?) {Cow (Bos taurus)}
spslfnpeefmpldptqepifppellrlkdvppkqlrfegervtwiqastlkelldlkaq
hpeaklvvgnteigiemkfknqlfpmiicpawipelnavehgpegisfgaacalssvekt
lleavaklptqktevfrgvleqlrwfagkqvksvaslggniitaspisdlnpvfmasgtk
ltivsrgtrrtvpmdhtffpsyrktllgpeeillsieipysre

SCOP Domain Coordinates for d1v97a6:

Click to download the PDB-style file with coordinates for d1v97a6.
(The format of our PDB-style files is described here.)

Timeline for d1v97a6: