Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.1: Class II aaRS ABD-related [52954] (2 families) |
Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins) |
Protein Nuclear receptor coactivator 5 (KIAA1637) [110619] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [110620] (1 PDB entry) Uniprot Q9HCD5 197-313 |
Domain d1v95a_: 1v95 A: [108435] Structural genomics target |
PDB Entry: 1v95 (more details)
SCOPe Domain Sequences for d1v95a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v95a_ c.51.1.1 (A:) Nuclear receptor coactivator 5 (KIAA1637) {Human (Homo sapiens) [TaxId: 9606]} gssgssgpvdcsvivvnkqtkdyaesvgrkvrdlgmvvdliflntevslsqaledvsrgg spfaivitqqhqihrsctvnimfgtpqehrnmpqadamvlvarnyeryknecrekereei arqasgpssg
Timeline for d1v95a_: