Lineage for d1v95a_ (1v95 A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 585719Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 585720Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) (S)
  5. 585721Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
  6. 585757Protein Nuclear receptor coactivator 5 (KIAA1637) [110619] (1 species)
  7. 585758Species Human (Homo sapiens) [TaxId:9606] [110620] (1 PDB entry)
  8. 585759Domain d1v95a_: 1v95 A: [108435]
    Structural genomics target

Details for d1v95a_

PDB Entry: 1v95 (more details)

PDB Description: solution structure of anticodon binding domain from nuclear receptor coactivator 5 (human kiaa1637 protein)

SCOP Domain Sequences for d1v95a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v95a_ c.51.1.1 (A:) Nuclear receptor coactivator 5 (KIAA1637) {Human (Homo sapiens)}
gssgssgpvdcsvivvnkqtkdyaesvgrkvrdlgmvvdliflntevslsqaledvsrgg
spfaivitqqhqihrsctvnimfgtpqehrnmpqadamvlvarnyeryknecrekereei
arqasgpssg

SCOP Domain Coordinates for d1v95a_:

Click to download the PDB-style file with coordinates for d1v95a_.
(The format of our PDB-style files is described here.)

Timeline for d1v95a_: