![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
![]() | Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) ![]() |
![]() | Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins) |
![]() | Protein Nuclear receptor coactivator 5 (KIAA1637) [110619] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [110620] (1 PDB entry) |
![]() | Domain d1v95a_: 1v95 A: [108435] Structural genomics target |
PDB Entry: 1v95 (more details)
SCOP Domain Sequences for d1v95a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v95a_ c.51.1.1 (A:) Nuclear receptor coactivator 5 (KIAA1637) {Human (Homo sapiens)} gssgssgpvdcsvivvnkqtkdyaesvgrkvrdlgmvvdliflntevslsqaledvsrgg spfaivitqqhqihrsctvnimfgtpqehrnmpqadamvlvarnyeryknecrekereei arqasgpssg
Timeline for d1v95a_: