| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) ![]() |
| Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins) |
| Protein Nuclear receptor coactivator 5 (KIAA1637) [110619] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [110620] (1 PDB entry) Uniprot Q9HCD5 197-313 |
| Domain d1v95a1: 1v95 A:8-124 [108435] Other proteins in same PDB: d1v95a2, d1v95a3 Structural genomics target |
PDB Entry: 1v95 (more details)
SCOPe Domain Sequences for d1v95a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v95a1 c.51.1.1 (A:8-124) Nuclear receptor coactivator 5 (KIAA1637) {Human (Homo sapiens) [TaxId: 9606]}
pvdcsvivvnkqtkdyaesvgrkvrdlgmvvdliflntevslsqaledvsrggspfaivi
tqqhqihrsctvnimfgtpqehrnmpqadamvlvarnyeryknecrekereeiarqa
Timeline for d1v95a1: