Lineage for d1v95a1 (1v95 A:8-124)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2881870Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2881871Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 2881872Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
  6. 2881915Protein Nuclear receptor coactivator 5 (KIAA1637) [110619] (1 species)
  7. 2881916Species Human (Homo sapiens) [TaxId:9606] [110620] (1 PDB entry)
    Uniprot Q9HCD5 197-313
  8. 2881917Domain d1v95a1: 1v95 A:8-124 [108435]
    Other proteins in same PDB: d1v95a2, d1v95a3
    Structural genomics target

Details for d1v95a1

PDB Entry: 1v95 (more details)

PDB Description: solution structure of anticodon binding domain from nuclear receptor coactivator 5 (human kiaa1637 protein)
PDB Compounds: (A:) Nuclear receptor coactivator 5

SCOPe Domain Sequences for d1v95a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v95a1 c.51.1.1 (A:8-124) Nuclear receptor coactivator 5 (KIAA1637) {Human (Homo sapiens) [TaxId: 9606]}
pvdcsvivvnkqtkdyaesvgrkvrdlgmvvdliflntevslsqaledvsrggspfaivi
tqqhqihrsctvnimfgtpqehrnmpqadamvlvarnyeryknecrekereeiarqa

SCOPe Domain Coordinates for d1v95a1:

Click to download the PDB-style file with coordinates for d1v95a1.
(The format of our PDB-style files is described here.)

Timeline for d1v95a1: