SCOPe 2.03: Domain d1v8xa_: 1v8x A:

Lineage for d1v8xa_ (1v8x A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
   automatically mapped to Pfam PF01126

6. Protein Heme oxygenase HmuO [89159] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [89160] (16 PDB entries)
   Uniprot P71119

8. Domain d1v8xa_: 1v8x A: [108432]
   complexed with hem, oxy, so4, suc

Details for d1v8xa_

PDB Entry: 1v8x, 1.85 Å

PDB Description: crystal structure of the dioxygen-bound heme oxygenase from corynebacterium diphtheriae

PDB Compounds: (A:) Heme oxygenase

SCOPe Domain Sequences for d1v8xa_:

Sequence; same for both SEQRES and ATOM records:

>d1v8xa_ a.132.1.1 (A:) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]}
taglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavr
asgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpa
lvahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnle
lsdeqrehllkeatdafvfnhqvfadlgkg

Timeline for d1v8xa_:

• d1v8xa_ first appeared in SCOP 1.69
  
• d1v8xa_ appears in SCOPe 2.02
  
• d1v8xa_ appears in SCOPe 2.04
  
• d1v8xa_ appears in the current release, SCOPe 2.08