Lineage for d1v8qd_ (1v8q D:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 567972Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 568118Superfamily b.84.4: Ribosomal L27 protein [110324] (1 family) (S)
    rudiment single hybrid fold with a permuted topology
  5. 568119Family b.84.4.1: Ribosomal L27 protein [110325] (1 protein)
    Pfam 01016
  6. 568120Protein TT0826 [110326] (1 species)
  7. 568121Species Thermus thermophilus [TaxId:274] [110327] (1 PDB entry)
  8. 568125Domain d1v8qd_: 1v8q D: [108431]
    Structural genomics target
    complexed with dtt

Details for d1v8qd_

PDB Entry: 1v8q (more details), 2.8 Å

PDB Description: Crystal structure of ribosomal protein L27 from Thermus thermophilus HB8
PDB Compounds: (D:)

SCOP Domain Sequences for d1v8qd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v8qd_ b.84.4.1 (D:) TT0826 {Thermus thermophilus}
rlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlfalvdgvvefqdrgrlgryv
hvrpla

SCOP Domain Coordinates for d1v8qd_:

Click to download the PDB-style file with coordinates for d1v8qd_.
(The format of our PDB-style files is described here.)

Timeline for d1v8qd_: