Lineage for d1v8qb_ (1v8q B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2426781Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2427110Superfamily b.84.4: Ribosomal L27 protein-like [110324] (3 families) (S)
    rudiment single hybrid fold with a permuted topology
  5. 2427111Family b.84.4.1: Ribosomal L27 protein [110325] (1 protein)
    Pfam PF01016
  6. 2427112Protein Ribosomal protein L27 [110326] (3 species)
  7. 2427151Species Thermus thermophilus [TaxId:274] [110327] (6 PDB entries)
    Uniprot P84123
  8. 2427153Domain d1v8qb_: 1v8q B: [108429]
    Structural genomics target
    complexed with dtt

Details for d1v8qb_

PDB Entry: 1v8q (more details), 2.8 Å

PDB Description: Crystal structure of ribosomal protein L27 from Thermus thermophilus HB8
PDB Compounds: (B:) tt0826

SCOPe Domain Sequences for d1v8qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v8qb_ b.84.4.1 (B:) Ribosomal protein L27 {Thermus thermophilus [TaxId: 274]}
rlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlfalvdgvvefqdrgrlgryv
hvrpla

SCOPe Domain Coordinates for d1v8qb_:

Click to download the PDB-style file with coordinates for d1v8qb_.
(The format of our PDB-style files is described here.)

Timeline for d1v8qb_: