Class b: All beta proteins [48724] (178 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.4: Ribosomal L27 protein-like [110324] (3 families) rudiment single hybrid fold with a permuted topology |
Family b.84.4.1: Ribosomal L27 protein [110325] (1 protein) Pfam PF01016 |
Protein Ribosomal protein L27 [110326] (3 species) |
Species Thermus thermophilus [TaxId:274] [110327] (6 PDB entries) Uniprot P84123 |
Domain d1v8qa_: 1v8q A: [108428] Structural genomics target complexed with dtt |
PDB Entry: 1v8q (more details), 2.8 Å
SCOPe Domain Sequences for d1v8qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v8qa_ b.84.4.1 (A:) Ribosomal protein L27 {Thermus thermophilus [TaxId: 274]} rlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlfalvdgvvefqdrgrlgryv hvrpla
Timeline for d1v8qa_: