Lineage for d1v8db_ (1v8d B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1886392Fold c.140: TTHA0583/YokD-like [110709] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest
  4. 1886393Superfamily c.140.1: TTHA0583/YokD-like [110710] (3 families) (S)
  5. 1886394Family c.140.1.1: Hypothetical protein TT1679 [110711] (1 protein)
    Pfam PF04260, DUF436
  6. 1886395Protein Hypothetical protein TT1679 [110712] (1 species)
    UPF0340 protein TTHA0583
  7. 1886396Species Thermus thermophilus [TaxId:274] [110713] (1 PDB entry)
    Uniprot P68591
  8. 1886398Domain d1v8db_: 1v8d B: [108426]
    Structural genomics target
    complexed with zn

Details for d1v8db_

PDB Entry: 1v8d (more details), 2.16 Å

PDB Description: Crystal structure of the conserved hypothetical protein TT1679 from Thermus thermophilus
PDB Compounds: (B:) hypothetical protein (TT1679)

SCOPe Domain Sequences for d1v8db_:

Sequence, based on SEQRES records: (download)

>d1v8db_ c.140.1.1 (B:) Hypothetical protein TT1679 {Thermus thermophilus [TaxId: 274]}
megirraaqraaeeflqafpmapgslfvlggstsevlgervgtrpsleaahavlegllpp
llergvhvavqacehlnralvveretarafgkeevavfphpkaggakataaflrfrdpvm
veslkaqahggmdiggvligmhlrpvavplrlsvrkigeavllaaktrpklvggaravyt
reemlkklee

Sequence, based on observed residues (ATOM records): (download)

>d1v8db_ c.140.1.1 (B:) Hypothetical protein TT1679 {Thermus thermophilus [TaxId: 274]}
megirraaqraaeeflqafpmapgslfvlggstsevltrpsleaahavlegllppllerg
vhvavqacehlnralvveretarafgkeevavfphpkaggakataaflrfrdpvmveslk
aqahggmdiggvligmhlrpvavplrlsvrkigeavllaaktrpklvggaravytreeml
kklee

SCOPe Domain Coordinates for d1v8db_:

Click to download the PDB-style file with coordinates for d1v8db_.
(The format of our PDB-style files is described here.)

Timeline for d1v8db_: