SCOP 1.73: Domain d1v8db_: 1v8d B:

Lineage for d1v8db_ (1v8d B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.140: Hypothetical protein TT1679 [110709] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest

4. Superfamily c.140.1: Hypothetical protein TT1679 [110710] (1 family)

5. Family c.140.1.1: Hypothetical protein TT1679 [110711] (1 protein)
   Pfam PF04260, DUF436

6. Protein Hypothetical protein TT1679 [110712] (1 species)
   UPF0340 protein TTHA0583

7. Species Thermus thermophilus [TaxId:274] [110713] (1 PDB entry)

8. Domain d1v8db_: 1v8d B: [108426]

Details for d1v8db_

PDB Entry: 1v8d, 2.16 Å

PDB Description: Crystal structure of the conserved hypothetical protein TT1679 from Thermus thermophilus

PDB Compounds: (B:) hypothetical protein (TT1679)

SCOP Domain Sequences for d1v8db_:

Sequence, based on SEQRES records:

>d1v8db_ c.140.1.1 (B:) Hypothetical protein TT1679 {Thermus thermophilus [TaxId: 274]}
megirraaqraaeeflqafpmapgslfvlggstsevlgervgtrpsleaahavlegllpp
llergvhvavqacehlnralvveretarafgkeevavfphpkaggakataaflrfrdpvm
veslkaqahggmdiggvligmhlrpvavplrlsvrkigeavllaaktrpklvggaravyt
reemlkklee

Sequence, based on observed residues (ATOM records):

>d1v8db_ c.140.1.1 (B:) Hypothetical protein TT1679 {Thermus thermophilus [TaxId: 274]}
megirraaqraaeeflqafpmapgslfvlggstsevltrpsleaahavlegllppllerg
vhvavqacehlnralvveretarafgkeevavfphpkaggakataaflrfrdpvmveslk
aqahggmdiggvligmhlrpvavplrlsvrkigeavllaaktrpklvggaravytreeml
kklee

Timeline for d1v8db_:

• d1v8db_ first appeared in SCOP 1.69
  
• d1v8db_ appears in SCOP 1.71
  
• d1v8db_ appears in SCOP 1.75
  
• d1v8db_ appears in the current release, SCOPe 2.08