Lineage for d1v8da_ (1v8d A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 849559Fold c.140: TTHA0583/YokD-like [110709] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest
  4. 849560Superfamily c.140.1: TTHA0583/YokD-like [110710] (2 families) (S)
  5. 849561Family c.140.1.1: Hypothetical protein TT1679 [110711] (1 protein)
    Pfam PF04260, DUF436
  6. 849562Protein Hypothetical protein TT1679 [110712] (1 species)
    UPF0340 protein TTHA0583
  7. 849563Species Thermus thermophilus [TaxId:274] [110713] (1 PDB entry)
    Uniprot P68591
  8. 849564Domain d1v8da_: 1v8d A: [108425]
    Structural genomics target

Details for d1v8da_

PDB Entry: 1v8d (more details), 2.16 Å

PDB Description: Crystal structure of the conserved hypothetical protein TT1679 from Thermus thermophilus
PDB Compounds: (A:) hypothetical protein (TT1679)

SCOP Domain Sequences for d1v8da_:

Sequence, based on SEQRES records: (download)

>d1v8da_ c.140.1.1 (A:) Hypothetical protein TT1679 {Thermus thermophilus [TaxId: 274]}
megirraaqraaeeflqafpmapgslfvlggstsevlgervgtrpsleaahavlegllpp
llergvhvavqacehlnralvveretarafgkeevavfphpkaggakataaflrfrdpvm
veslkaqahggmdiggvligmhlrpvavplrlsvrkigeavllaaktrpklvggaravyt
reemlkkleeflp

Sequence, based on observed residues (ATOM records): (download)

>d1v8da_ c.140.1.1 (A:) Hypothetical protein TT1679 {Thermus thermophilus [TaxId: 274]}
megirraaqraaeeflqafpmapgslfvlggstsevlgtrpsleaahavlegllppller
gvhvavqacehlnralvveretarafgkeevavfphpkaggakataaflrfrdpvmvesl
kaqahggmdiggvligmhlrpvavplrlsvrkigeavllaaktrpklvggaravytreem
lkkleeflp

SCOP Domain Coordinates for d1v8da_:

Click to download the PDB-style file with coordinates for d1v8da_.
(The format of our PDB-style files is described here.)

Timeline for d1v8da_: