SCOP 1.71: Domain d1v8da_: 1v8d A:

Lineage for d1v8da_ (1v8d A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.140: Hypothetical protein TT1679 [110709] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest

4. Superfamily c.140.1: Hypothetical protein TT1679 [110710] (1 family)

5. Family c.140.1.1: Hypothetical protein TT1679 [110711] (1 protein)
   Pfam 04260, DUF436

6. Protein Hypothetical protein TT1679 [110712] (1 species)
   UPF0340 protein TTHA0583

7. Species Thermus thermophilus [TaxId:274] [110713] (1 PDB entry)

8. Domain d1v8da_: 1v8d A: [108425]

Details for d1v8da_

PDB Entry: 1v8d, 2.16 Å

PDB Description: Crystal structure of the conserved hypothetical protein TT1679 from Thermus thermophilus

SCOP Domain Sequences for d1v8da_:

Sequence, based on SEQRES records:

>d1v8da_ c.140.1.1 (A:) Hypothetical protein TT1679 {Thermus thermophilus}
megirraaqraaeeflqafpmapgslfvlggstsevlgervgtrpsleaahavlegllpp
llergvhvavqacehlnralvveretarafgkeevavfphpkaggakataaflrfrdpvm
veslkaqahggmdiggvligmhlrpvavplrlsvrkigeavllaaktrpklvggaravyt
reemlkkleeflp

Sequence, based on observed residues (ATOM records):

>d1v8da_ c.140.1.1 (A:) Hypothetical protein TT1679 {Thermus thermophilus}
megirraaqraaeeflqafpmapgslfvlggstsevlgtrpsleaahavlegllppller
gvhvavqacehlnralvveretarafgkeevavfphpkaggakataaflrfrdpvmvesl
kaqahggmdiggvligmhlrpvavplrlsvrkigeavllaaktrpklvggaravytreem
lkkleeflp

Timeline for d1v8da_:

• d1v8da_ first appeared in SCOP 1.69
  
• d1v8da_ appears in SCOP 1.73
  
• d1v8da_ appears in the current release, SCOPe 2.08