Lineage for d1v8da_ (1v8d A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 496761Fold c.140: Hypothetical protein TT1679 [110709] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest
  4. 496762Superfamily c.140.1: Hypothetical protein TT1679 [110710] (1 family) (S)
  5. 496763Family c.140.1.1: Hypothetical protein TT1679 [110711] (1 protein)
    pfam04260, DUF436
  6. 496764Protein Hypothetical protein TT1679 [110712] (1 species)
    UPF0340 protein TTHA0583
  7. 496765Species Thermus thermophilus [TaxId:274] [110713] (1 PDB entry)
  8. 496766Domain d1v8da_: 1v8d A: [108425]

Details for d1v8da_

PDB Entry: 1v8d (more details), 2.16 Å

PDB Description: Crystal structure of the conserved hypothetical protein TT1679 from Thermus thermophilus

SCOP Domain Sequences for d1v8da_:

Sequence, based on SEQRES records: (download)

>d1v8da_ c.140.1.1 (A:) Hypothetical protein TT1679 {Thermus thermophilus}
megirraaqraaeeflqafpmapgslfvlggstsevlgervgtrpsleaahavlegllpp
llergvhvavqacehlnralvveretarafgkeevavfphpkaggakataaflrfrdpvm
veslkaqahggmdiggvligmhlrpvavplrlsvrkigeavllaaktrpklvggaravyt
reemlkkleeflp

Sequence, based on observed residues (ATOM records): (download)

>d1v8da_ c.140.1.1 (A:) Hypothetical protein TT1679 {Thermus thermophilus}
megirraaqraaeeflqafpmapgslfvlggstsevlgtrpsleaahavlegllppller
gvhvavqacehlnralvveretarafgkeevavfphpkaggakataaflrfrdpvmvesl
kaqahggmdiggvligmhlrpvavplrlsvrkigeavllaaktrpklvggaravytreem
lkkleeflp

SCOP Domain Coordinates for d1v8da_:

Click to download the PDB-style file with coordinates for d1v8da_.
(The format of our PDB-style files is described here.)

Timeline for d1v8da_: