Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.140: Hypothetical protein TT1679 [110709] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest |
Superfamily c.140.1: Hypothetical protein TT1679 [110710] (1 family) |
Family c.140.1.1: Hypothetical protein TT1679 [110711] (1 protein) pfam04260, DUF436 |
Protein Hypothetical protein TT1679 [110712] (1 species) UPF0340 protein TTHA0583 |
Species Thermus thermophilus [TaxId:274] [110713] (1 PDB entry) |
Domain d1v8da_: 1v8d A: [108425] |
PDB Entry: 1v8d (more details), 2.16 Å
SCOP Domain Sequences for d1v8da_:
Sequence, based on SEQRES records: (download)
>d1v8da_ c.140.1.1 (A:) Hypothetical protein TT1679 {Thermus thermophilus} megirraaqraaeeflqafpmapgslfvlggstsevlgervgtrpsleaahavlegllpp llergvhvavqacehlnralvveretarafgkeevavfphpkaggakataaflrfrdpvm veslkaqahggmdiggvligmhlrpvavplrlsvrkigeavllaaktrpklvggaravyt reemlkkleeflp
>d1v8da_ c.140.1.1 (A:) Hypothetical protein TT1679 {Thermus thermophilus} megirraaqraaeeflqafpmapgslfvlggstsevlgtrpsleaahavlegllppller gvhvavqacehlnralvveretarafgkeevavfphpkaggakataaflrfrdpvmvesl kaqahggmdiggvligmhlrpvavplrlsvrkigeavllaaktrpklvggaravytreem lkkleeflp
Timeline for d1v8da_: