Lineage for d1v89a_ (1v89 A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 563841Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 563842Superfamily b.55.1: PH domain-like [50729] (9 families) (S)
  5. 563843Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (30 proteins)
    Pfam 00169
  6. 563960Protein Rho-GTPase-activating protein 25 (KIAA0053) [110268] (1 species)
  7. 563961Species Human (Homo sapiens) [TaxId:9606] [110269] (1 PDB entry)
  8. 563962Domain d1v89a_: 1v89 A: [108424]
    Structural genomics target

Details for d1v89a_

PDB Entry: 1v89 (more details)

PDB Description: Solution Structure of the Pleckstrin Homology Domain of Human KIAA0053 Protein

SCOP Domain Sequences for d1v89a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens)}
gssgssgpikmgwlkkqrsivknwqqryfvlraqqlyyykdeedtkpqgcmylpgctike
iatnpeeagkfvfeiipaswdqnrmgqdsyvlmassqaemeewvkflrrvagsgpssg

SCOP Domain Coordinates for d1v89a_:

Click to download the PDB-style file with coordinates for d1v89a_.
(The format of our PDB-style files is described here.)

Timeline for d1v89a_: