Lineage for d1v89a1 (1v89 A:8-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803067Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2803281Protein Rho-GTPase-activating protein 25 (KIAA0053) [110268] (1 species)
  7. 2803282Species Human (Homo sapiens) [TaxId:9606] [110269] (1 PDB entry)
    Uniprot P42331 40-144
  8. 2803283Domain d1v89a1: 1v89 A:8-112 [108424]
    Other proteins in same PDB: d1v89a2, d1v89a3
    Structural genomics target

Details for d1v89a1

PDB Entry: 1v89 (more details)

PDB Description: solution structure of the pleckstrin homology domain of human kiaa0053 protein
PDB Compounds: (A:) Hypothetical protein KIAA0053

SCOPe Domain Sequences for d1v89a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v89a1 b.55.1.1 (A:8-112) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]}
pikmgwlkkqrsivknwqqryfvlraqqlyyykdeedtkpqgcmylpgctikeiatnpee
agkfvfeiipaswdqnrmgqdsyvlmassqaemeewvkflrrvag

SCOPe Domain Coordinates for d1v89a1:

Click to download the PDB-style file with coordinates for d1v89a1.
(The format of our PDB-style files is described here.)

Timeline for d1v89a1: