Lineage for d1v88a_ (1v88 A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 563841Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 563842Superfamily b.55.1: PH domain-like [50729] (9 families) (S)
  5. 563843Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (30 proteins)
    Pfam 00169
  6. 563924Protein Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) [110266] (1 species)
  7. 563925Species Human (Homo sapiens) [TaxId:9606] [110267] (1 PDB entry)
  8. 563926Domain d1v88a_: 1v88 A: [108423]
    Structural genomics target

Details for d1v88a_

PDB Entry: 1v88 (more details)

PDB Description: solution structure of the pleckstrin homology domain of oxysterol- binding protein-related protein 8 (kiaa1451 protein)

SCOP Domain Sequences for d1v88a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens)}
gssgssgivmadwlkirgtlkswtklwcvlkpgvlliyktqkngqwvgtvllnaceiier
pskkdgfcfklfhpleqsiwavkgpkgeavgsitqplpssyliiratsesdgrcwmdale
lalksgpssg

SCOP Domain Coordinates for d1v88a_:

Click to download the PDB-style file with coordinates for d1v88a_.
(The format of our PDB-style files is described here.)

Timeline for d1v88a_: