Lineage for d1v86a_ (1v86 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1402145Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1402146Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1402227Protein hypothetical D7wsu128e protein [110800] (1 species)
  7. 1402228Species Mouse (Mus musculus) [TaxId:10090] [110801] (1 PDB entry)
    Uniprot Q78JW9 76-157
  8. 1402229Domain d1v86a_: 1v86 A: [108421]
    Structural genomics target

Details for d1v86a_

PDB Entry: 1v86 (more details)

PDB Description: Solution structure of the ubiquitin domain from mouse D7Wsu128e protein
PDB Compounds: (A:) DNA segment, Chr 7, Wayne State University 128, expressed

SCOPe Domain Sequences for d1v86a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgdagggvgkelvdlkiiwnktkhdvkvpldstgselkqkihsitglppamqkvm
ykglvpedktlreikvtsgakimvvgstisgpssg

SCOPe Domain Coordinates for d1v86a_:

Click to download the PDB-style file with coordinates for d1v86a_.
(The format of our PDB-style files is described here.)

Timeline for d1v86a_: