Lineage for d1v86a_ (1v86 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499486Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 499487Superfamily d.15.1: Ubiquitin-like [54236] (6 families) (S)
  5. 499488Family d.15.1.1: Ubiquitin-related [54237] (17 proteins)
  6. 499503Protein hypothetical D7wsu128e protein [110800] (1 species)
  7. 499504Species Mouse (Mus musculus) [TaxId:10090] [110801] (1 PDB entry)
  8. 499505Domain d1v86a_: 1v86 A: [108421]
    Structural genomics target

Details for d1v86a_

PDB Entry: 1v86 (more details)

PDB Description: solution structure of the ubiquitin domain from mouse d7wsu128e protein

SCOP Domain Sequences for d1v86a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus)}
gssgssgdagggvgkelvdlkiiwnktkhdvkvpldstgselkqkihsitglppamqkvm
ykglvpedktlreikvtsgakimvvgstisgpssg

SCOP Domain Coordinates for d1v86a_:

Click to download the PDB-style file with coordinates for d1v86a_.
(The format of our PDB-style files is described here.)

Timeline for d1v86a_: