![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein hypothetical D7wsu128e protein [110800] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [110801] (1 PDB entry) Uniprot Q78JW9 76-157 |
![]() | Domain d1v86a1: 1v86 A:8-89 [108421] Other proteins in same PDB: d1v86a2, d1v86a3 Structural genomics target |
PDB Entry: 1v86 (more details)
SCOPe Domain Sequences for d1v86a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v86a1 d.15.1.1 (A:8-89) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} dagggvgkelvdlkiiwnktkhdvkvpldstgselkqkihsitglppamqkvmykglvpe dktlreikvtsgakimvvgsti
Timeline for d1v86a1: