Lineage for d1v86a1 (1v86 A:8-89)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931403Protein hypothetical D7wsu128e protein [110800] (1 species)
  7. 2931404Species Mouse (Mus musculus) [TaxId:10090] [110801] (1 PDB entry)
    Uniprot Q78JW9 76-157
  8. 2931405Domain d1v86a1: 1v86 A:8-89 [108421]
    Other proteins in same PDB: d1v86a2, d1v86a3
    Structural genomics target

Details for d1v86a1

PDB Entry: 1v86 (more details)

PDB Description: solution structure of the ubiquitin domain from mouse d7wsu128e protein
PDB Compounds: (A:) DNA segment, Chr 7, Wayne State University 128, expressed

SCOPe Domain Sequences for d1v86a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v86a1 d.15.1.1 (A:8-89) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]}
dagggvgkelvdlkiiwnktkhdvkvpldstgselkqkihsitglppamqkvmykglvpe
dktlreikvtsgakimvvgsti

SCOPe Domain Coordinates for d1v86a1:

Click to download the PDB-style file with coordinates for d1v86a1.
(The format of our PDB-style files is described here.)

Timeline for d1v86a1: