Lineage for d1v84b1 (1v84 B:83-334)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133441Family c.68.1.7: 1,3-glucuronyltransferase [53467] (3 protein domains)
    automatically mapped to Pfam PF03360
  6. 2133450Protein Beta-1,3-glucuronyltransferase 1, GlcAT-P [110687] (1 species)
  7. 2133451Species Human (Homo sapiens) [TaxId:9606] [110688] (3 PDB entries)
    Uniprot Q9P2W7
  8. 2133453Domain d1v84b1: 1v84 B:83-334 [108420]
    Other proteins in same PDB: d1v84b2
    complexed with mn, tla, udp

Details for d1v84b1

PDB Entry: 1v84 (more details), 1.82 Å

PDB Description: Crystal structure of human GlcAT-P in complex with N-acetyllactosamine, Udp, and Mn2+
PDB Compounds: (B:) Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1

SCOPe Domain Sequences for d1v84b1:

Sequence, based on SEQRES records: (download)

>d1v84b1 c.68.1.7 (B:83-334) Beta-1,3-glucuronyltransferase 1, GlcAT-P {Human (Homo sapiens) [TaxId: 9606]}
lptihvvtptysrpvqkaeltrmantllhvpnlhwlvvedaprrtpltarllrdtglnyt
hlhvetprnyklrgdardpriprgtmqrnlalrwlretfprnssqpgvvyfadddntysl
elfeemrstrrvsvwpvafvgglryeaprvngagkvvrwktvfdphrpfaidmagfavnl
rlilqrsqayfklrgvkggyqessllrelvtlndlepkaanctkilvwhtrtekpvlvne
gkkgftdpsvei

Sequence, based on observed residues (ATOM records): (download)

>d1v84b1 c.68.1.7 (B:83-334) Beta-1,3-glucuronyltransferase 1, GlcAT-P {Human (Homo sapiens) [TaxId: 9606]}
lptihvvtptysrpvqkaeltrmantllhvpnlhwlvvedaprrtpltarllrdtglnyt
hlhvetprnyiprgtmqrnlalrwlretfprnssqpgvvyfadddntyslelfeemrstr
rvsvwpvafvgglryeaprvngagkvvrwktvfdphrpfaidmagfavnlrlilqrsqay
fklrgvkggyqessllrelvtlndlepkaanctkilvwhtrtekpvlvnegkkgftdpsv
ei

SCOPe Domain Coordinates for d1v84b1:

Click to download the PDB-style file with coordinates for d1v84b1.
(The format of our PDB-style files is described here.)

Timeline for d1v84b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v84b2
View in 3D
Domains from other chains:
(mouse over for more information)
d1v84a_