Lineage for d1v84a_ (1v84 A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 491356Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 491357Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (13 families) (S)
  5. 491521Family c.68.1.7: 1,3-glucuronyltransferase [53467] (2 proteins)
  6. 491528Protein Beta-1,3-glucuronyltransferase 1, GlcAT-P [110687] (1 species)
  7. 491529Species Human (Homo sapiens) [TaxId:9606] [110688] (3 PDB entries)
  8. 491532Domain d1v84a_: 1v84 A: [108419]

Details for d1v84a_

PDB Entry: 1v84 (more details), 1.82 Å

PDB Description: Crystal structure of human GlcAT-P in complex with N-acetyllactosamine, Udp, and Mn2+

SCOP Domain Sequences for d1v84a_:

Sequence, based on SEQRES records: (download)

>d1v84a_ c.68.1.7 (A:) Beta-1,3-glucuronyltransferase 1, GlcAT-P {Human (Homo sapiens)}
lptihvvtptysrpvqkaeltrmantllhvpnlhwlvvedaprrtpltarllrdtglnyt
hlhvetprnyklrgdardpriprgtmqrnlalrwlretfprnssqpgvvyfadddntysl
elfeemrstrrvsvwpvafvgglryeaprvngagkvvrwktvfdphrpfaidmagfavnl
rlilqrsqayfklrgvkggyqessllrelvtlndlepkaanctkilvwhtrtekpvlvne
gkkgftdpsvei

Sequence, based on observed residues (ATOM records): (download)

>d1v84a_ c.68.1.7 (A:) Beta-1,3-glucuronyltransferase 1, GlcAT-P {Human (Homo sapiens)}
lptihvvtptysrpvqkaeltrmantllhvpnlhwlvvedaprrtpltarllrdtglnyt
hlhvetprnyklriprgtmqrnlalrwlretfprnssqpgvvyfadddntyslelfeemr
strrvsvwpvafvgglryeaprvngagkvvrwktvfdphrpfaidmagfavnlrlilqrs
qayfklrgvkggyqessllrelvtlndlepkaanctkilvwhtrtekpvlvnegkkgftd
psvei

SCOP Domain Coordinates for d1v84a_:

Click to download the PDB-style file with coordinates for d1v84a_.
(The format of our PDB-style files is described here.)

Timeline for d1v84a_: