SCOPe 2.02: Domain d1v7xa2: 1v7x A:1-270

Lineage for d1v7xa2 (1v7x A:1-270)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.30: Supersandwich [49993] (3 superfamilies)
   sandwich; 18 strands in 2 sheets

4. Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families)
   probable carbohydrate-binding domain in enzymes acting on sugars

5. Family b.30.5.3: Glycosyltransferase family 36 N-terminal domain [63733] (2 proteins)
   overall domain organization is similar to Bacterial glucoamylase

6. Protein Chitobiose phosphorylase ChbP [110146] (1 species)

7. Species Vibrio proteolyticus [TaxId:671] [110147] (3 PDB entries)
   Uniprot Q76IQ9

8. Domain d1v7xa2: 1v7x A:1-270 [108414]
   Other proteins in same PDB: d1v7xa1
   complexed with ca, nag, ndg, so4

Details for d1v7xa2

PDB Entry: 1v7x, 2 Å

PDB Description: crystal structure of vibrio proteolyticus chitobiose phosphorylase in complex with glcnac and sulfate

PDB Compounds: (A:) chitobiose phosphorylase

SCOPe Domain Sequences for d1v7xa2:

Sequence; same for both SEQRES and ATOM records:

>d1v7xa2 b.30.5.3 (A:1-270) Chitobiose phosphorylase ChbP {Vibrio proteolyticus [TaxId: 671]}
mkygyfdndnreyvitrpdvpapwtnylgtekfctvishnaggysfynspeynrvtkfrp
natfdrpghyvylrdddsgdywsiswqpvaksldeaqyqirhglsyskfqcdyngihark
tlfvpkgedaeiwdvvikntsdqvrtisafsfvefsfshiqsdnqnhqmslysagtayrp
glieydlyyntddfegfyylastfdpdsydgqrdrflglyrdeanplaveqgrcsnsaqt
cynhcgslhkqftlqpgeeirfayilgigk

Timeline for d1v7xa2:

• d1v7xa2 first appeared in SCOP 1.69
  
• d1v7xa2 appears in SCOPe 2.01
  
• d1v7xa2 appears in SCOPe 2.03
  
• d1v7xa2 appears in the current release, SCOPe 2.08