Lineage for d1v7xa2 (1v7x A:1-270)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 460730Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 460800Superfamily b.30.5: Galactose mutarotase-like [74650] (10 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 460979Family b.30.5.3: Glycosyltransferase family 36 N-terminal domain [63733] (2 proteins)
    overall domain organization is similar to Bacterial glucoamylase
  6. 460980Protein Chitobiose phosphorylase ChbP [110146] (1 species)
  7. 460981Species Vibrio proteolyticus [TaxId:671] [110147] (3 PDB entries)
  8. 460984Domain d1v7xa2: 1v7x A:1-270 [108414]
    Other proteins in same PDB: d1v7xa1

Details for d1v7xa2

PDB Entry: 1v7x (more details), 2 Å

PDB Description: crystal structure of vibrio proteolyticus chitobiose phosphorylase in complex with glcnac and sulfate

SCOP Domain Sequences for d1v7xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v7xa2 b.30.5.3 (A:1-270) Chitobiose phosphorylase ChbP {Vibrio proteolyticus}
mkygyfdndnreyvitrpdvpapwtnylgtekfctvishnaggysfynspeynrvtkfrp
natfdrpghyvylrdddsgdywsiswqpvaksldeaqyqirhglsyskfqcdyngihark
tlfvpkgedaeiwdvvikntsdqvrtisafsfvefsfshiqsdnqnhqmslysagtayrp
glieydlyyntddfegfyylastfdpdsydgqrdrflglyrdeanplaveqgrcsnsaqt
cynhcgslhkqftlqpgeeirfayilgigk

SCOP Domain Coordinates for d1v7xa2:

Click to download the PDB-style file with coordinates for d1v7xa2.
(The format of our PDB-style files is described here.)

Timeline for d1v7xa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v7xa1