![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
![]() | Family b.30.5.3: Glycosyltransferase family 36 N-terminal domain [63733] (2 proteins) overall domain organization is similar to Bacterial glucoamylase |
![]() | Protein Chitobiose phosphorylase ChbP [110146] (1 species) |
![]() | Species Vibrio proteolyticus [TaxId:671] [110147] (3 PDB entries) Uniprot Q76IQ9 |
![]() | Domain d1v7xa2: 1v7x A:1-270 [108414] Other proteins in same PDB: d1v7xa1 complexed with ca, nag, ndg, so4 |
PDB Entry: 1v7x (more details), 2 Å
SCOPe Domain Sequences for d1v7xa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v7xa2 b.30.5.3 (A:1-270) Chitobiose phosphorylase ChbP {Vibrio proteolyticus [TaxId: 671]} mkygyfdndnreyvitrpdvpapwtnylgtekfctvishnaggysfynspeynrvtkfrp natfdrpghyvylrdddsgdywsiswqpvaksldeaqyqirhglsyskfqcdyngihark tlfvpkgedaeiwdvvikntsdqvrtisafsfvefsfshiqsdnqnhqmslysagtayrp glieydlyyntddfegfyylastfdpdsydgqrdrflglyrdeanplaveqgrcsnsaqt cynhcgslhkqftlqpgeeirfayilgigk
Timeline for d1v7xa2: