Lineage for d1v7xa1 (1v7x A:271-801)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004206Family a.102.1.4: Glycosyltransferase family 36 C-terminal domain [63588] (2 protein domains)
    overall domain organization is similar to Bacterial glucoamylase
  6. 2004207Protein Chitobiose phosphorylase ChbP [109951] (1 species)
  7. 2004208Species Vibrio proteolyticus [TaxId:671] [109952] (3 PDB entries)
    Uniprot Q76IQ9
  8. 2004211Domain d1v7xa1: 1v7x A:271-801 [108413]
    Other proteins in same PDB: d1v7xa2
    complexed with ca, nag, ndg, so4

Details for d1v7xa1

PDB Entry: 1v7x (more details), 2 Å

PDB Description: Crystal structure of Vibrio proteolyticus chitobiose phosphorylase in complex with GlcNAc and sulfate
PDB Compounds: (A:) chitobiose phosphorylase

SCOPe Domain Sequences for d1v7xa1:

Sequence, based on SEQRES records: (download)

>d1v7xa1 a.102.1.4 (A:271-801) Chitobiose phosphorylase ChbP {Vibrio proteolyticus [TaxId: 671]}
gngerlrehyqdvanidaafaaikahwdercakfqvkspnqgldtminawtlyqaetcvv
wsrfasfievggrtglgyrdtaqdaisvphanpemtrkrivdllrgqvkagyglhlfdpd
wfdpekedvapsksptvvptpsdedkihgikdtcsddhlwliptickyvmetgetsffdq
mipyadggeasvyehmkaaldfsaeyvgqtgickglradwndclnlgggessmvsflhfw
alqefidlakflgkdqdvntytemaanvreacethlwddeggwyirgltkngdkigtaqq
qegrvhlesntlavlsglasqergeqamdavdehlfspyglhlnapsfstpnddigfvtr
vyqgvkengaifshpnpwawvaetklgrgdramkfydalnpynqndiiekriaepysyvq
fimgrdhqdhgranhpwltgtsgwayfavtnyilgvqsgftglsvdpcipsdwpgfevtr
qwrgatyhiqvenpdhvskgvksitlngapiqgrippqaqgsdnqvvvvlg

Sequence, based on observed residues (ATOM records): (download)

>d1v7xa1 a.102.1.4 (A:271-801) Chitobiose phosphorylase ChbP {Vibrio proteolyticus [TaxId: 671]}
gngerlrehyqdvanidaafaaikahwdercakfqvkspnqgldtminawtlyqaetcvv
wsrfasfievggrtglgyrdtaqdaisvphanpemtrkrivdllrgqvkagyglhlfdpd
wfdpihgikdtcsddhlwliptickyvmetgetsffdqmipyadggeasvyehmkaaldf
saeyvgqtgickglradwndclnlgggessmvsflhfwalqefidlakflgkdqdvntyt
emaanvreacethlwddeggwyirgltkngdkigtaqqqegrvhlesntlavlsglasqe
rgeqamdavdehlfspyglhlnapsfstpnddigfvtrvyqgvkengaifshpnpwawva
etklgrgdramkfydalnpynqndiiekriaepysyvqfimgrdhqdhgranhpwltgts
gwayfavtnyilgvqsgftglsvdpcipsdwpgfevtrqwrgatyhiqvenpdhvskgvk
sitlngapiqgrippqaqgsdnqvvvvlg

SCOPe Domain Coordinates for d1v7xa1:

Click to download the PDB-style file with coordinates for d1v7xa1.
(The format of our PDB-style files is described here.)

Timeline for d1v7xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v7xa2