Class b: All beta proteins [48724] (178 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.3: Glycosyltransferase family 36 N-terminal domain [63733] (2 proteins) overall domain organization is similar to Bacterial glucoamylase |
Protein Chitobiose phosphorylase ChbP [110146] (1 species) |
Species Vibrio proteolyticus [TaxId:671] [110147] (3 PDB entries) Uniprot Q76IQ9 |
Domain d1v7wa2: 1v7w A:1-270 [108412] Other proteins in same PDB: d1v7wa1 complexed with ca, cl, nag, ndg |
PDB Entry: 1v7w (more details), 1.6 Å
SCOPe Domain Sequences for d1v7wa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v7wa2 b.30.5.3 (A:1-270) Chitobiose phosphorylase ChbP {Vibrio proteolyticus [TaxId: 671]} mkygyfdndnreyvitrpdvpapwtnylgtekfctvishnaggysfynspeynrvtkfrp natfdrpghyvylrdddsgdywsiswqpvaksldeaqyqirhglsyskfqcdyngihark tlfvpkgedaeiwdvvikntsdqvrtisafsfvefsfshiqsdnqnhqmslysagtayrp glieydlyyntddfegfyylastfdpdsydgqrdrflglyrdeanplaveqgrcsnsaqt cynhcgslhkqftlqpgeeirfayilgigk
Timeline for d1v7wa2: