Lineage for d1v7va2 (1v7v A:1-270)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 556788Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 556864Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 557043Family b.30.5.3: Glycosyltransferase family 36 N-terminal domain [63733] (2 proteins)
    overall domain organization is similar to Bacterial glucoamylase
  6. 557044Protein Chitobiose phosphorylase ChbP [110146] (1 species)
  7. 557045Species Vibrio proteolyticus [TaxId:671] [110147] (3 PDB entries)
  8. 557047Domain d1v7va2: 1v7v A:1-270 [108410]
    Other proteins in same PDB: d1v7va1
    complexed with ca

Details for d1v7va2

PDB Entry: 1v7v (more details), 1.8 Å

PDB Description: Crystal structure of Vibrio proteolyticus chitobiose phosphorylase

SCOP Domain Sequences for d1v7va2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v7va2 b.30.5.3 (A:1-270) Chitobiose phosphorylase ChbP {Vibrio proteolyticus}
mkygyfdndnreyvitrpdvpapwtnylgtekfctvishnaggysfynspeynrvtkfrp
natfdrpghyvylrdddsgdywsiswqpvaksldeaqyqirhglsyskfqcdyngihark
tlfvpkgedaeiwdvvikntsdqvrtisafsfvefsfshiqsdnqnhqmslysagtayrp
glieydlyyntddfegfyylastfdpdsydgqrdrflglyrdeanplaveqgrcsnsaqt
cynhcgslhkqftlqpgeeirfayilgigk

SCOP Domain Coordinates for d1v7va2:

Click to download the PDB-style file with coordinates for d1v7va2.
(The format of our PDB-style files is described here.)

Timeline for d1v7va2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v7va1