![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.62.1: vWA-like [53300] (6 families) ![]() |
![]() | Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins) |
![]() | Protein Integrin alpha2-beta1 [53313] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [53314] (3 PDB entries) Uniprot P17301 172-364 |
![]() | Domain d1v7pc_: 1v7p C: [108408] Other proteins in same PDB: d1v7pa_, d1v7pb_ complexed with cl, mn, nag, po4 |
PDB Entry: 1v7p (more details), 1.9 Å
SCOPe Domain Sequences for d1v7pc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v7pc_ c.62.1.1 (C:) Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId: 9606]} lidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntykt keemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsm lkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaall ekagtlgeqifsi
Timeline for d1v7pc_: