Lineage for d1v7pc_ (1v7p C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1378146Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1378147Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 1378148Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)
  6. 1378196Protein Integrin alpha2-beta1 [53313] (1 species)
  7. 1378197Species Human (Homo sapiens) [TaxId:9606] [53314] (3 PDB entries)
    Uniprot P17301 172-364
  8. 1378198Domain d1v7pc_: 1v7p C: [108408]
    Other proteins in same PDB: d1v7pa_, d1v7pb_
    complexed with cl, mn, nag, po4

Details for d1v7pc_

PDB Entry: 1v7p (more details), 1.9 Å

PDB Description: structure of ems16-alpha2-i domain complex
PDB Compounds: (C:) Integrin alpha-2

SCOPe Domain Sequences for d1v7pc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v7pc_ c.62.1.1 (C:) Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId: 9606]}
lidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntykt
keemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsm
lkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaall
ekagtlgeqifsi

SCOPe Domain Coordinates for d1v7pc_:

Click to download the PDB-style file with coordinates for d1v7pc_.
(The format of our PDB-style files is described here.)

Timeline for d1v7pc_: