SCOP 1.75: Domain d1v7pc_: 1v7p C:

Lineage for d1v7pc_ (1v7p C:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (5 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (10 proteins)

6. Protein Integrin alpha2-beta1 [53313] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53314] (3 PDB entries)
   Uniprot P17301 172-364

8. Domain d1v7pc_: 1v7p C: [108408]
   Other proteins in same PDB: d1v7pa_, d1v7pb_
   complexed with cl, mn, nag, po4; mutant

Details for d1v7pc_

PDB Entry: 1v7p, 1.9 Å

PDB Description: structure of ems16-alpha2-i domain complex

PDB Compounds: (C:) Integrin alpha-2

SCOP Domain Sequences for d1v7pc_:

Sequence; same for both SEQRES and ATOM records:

>d1v7pc_ c.62.1.1 (C:) Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId: 9606]}
lidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntykt
keemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsm
lkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaall
ekagtlgeqifsi

Timeline for d1v7pc_:

• d1v7pc_ first appeared in SCOP 1.69
  
• d1v7pc_ appears in SCOP 1.73
  
• d1v7pc_ appears in SCOPe 2.01
  
• d1v7pc_ appears in the current release, SCOPe 2.08