Lineage for d1v7pb_ (1v7p B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3001355Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 3001710Protein Snake coagglutinin beta chain [88867] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 3001740Species Snake (Echis multisquamatus), Ems16 [TaxId:93050] [103347] (2 PDB entries)
    Uniprot Q7T2Q0 27-153
  8. 3001741Domain d1v7pb_: 1v7p B: [108407]
    Other proteins in same PDB: d1v7pa_, d1v7pc_
    complexed with cl, mn, nag, po4

Details for d1v7pb_

PDB Entry: 1v7p (more details), 1.9 Å

PDB Description: structure of ems16-alpha2-i domain complex
PDB Compounds: (B:) EMS16 B chain

SCOPe Domain Sequences for d1v7pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v7pb_ d.169.1.1 (B:) Snake coagglutinin beta chain {Snake (Echis multisquamatus), Ems16 [TaxId: 93050]}
cplgwssfdqhcykvfepvknwteaeeicmqqhkgsrlasihsseeeafvsklaskalkf
tsmwiglnnpwkdckwewsdnarfdykawkrrpyctvmvvkpdrifwftrgceksvsfvc
kfltdpa

SCOPe Domain Coordinates for d1v7pb_:

Click to download the PDB-style file with coordinates for d1v7pb_.
(The format of our PDB-style files is described here.)

Timeline for d1v7pb_: