Lineage for d1v77a_ (1v77 A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 689534Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 689676Superfamily c.6.3: PHP domain-like [89550] (2 families) (S)
  5. 689693Family c.6.3.2: RNase P subunit p30 [110442] (1 protein)
    Pfam PF01876
  6. 689694Protein Ribonuclease P protein component 3, Rnp3 [110443] (1 species)
  7. 689695Species Pyrococcus horikoshii [TaxId:53953] [110444] (2 PDB entries)
  8. 689696Domain d1v77a_: 1v77 A: [108402]

Details for d1v77a_

PDB Entry: 1v77 (more details), 1.8 Å

PDB Description: crystal structure of the ph1877 protein
PDB Compounds: (A:) hypothetical protein PH1877

SCOP Domain Sequences for d1v77a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v77a_ c.6.3.2 (A:) Ribonuclease P protein component 3, Rnp3 {Pyrococcus horikoshii [TaxId: 53953]}
vkfiemdirdkeayelakewfdevvvsikfneevdkeklrearkeygkvaillsnpkpsl
vrdtvqkfksyliyvesndlrvirysiekgvdaiispwvnrkdpgidhvlaklmvkknva
lgfslrpllysnpyeranllrfmmkawklvekykvrrfltssaqekwdvryprdlislgv
vigmeipqakasismypeiilk

SCOP Domain Coordinates for d1v77a_:

Click to download the PDB-style file with coordinates for d1v77a_.
(The format of our PDB-style files is described here.)

Timeline for d1v77a_: