Lineage for d1v6ga2 (1v6g A:42-75)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262247Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2262248Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2262386Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. 2262387Protein Actin-binding LIM protein 2, abLIM2 [111441] (1 species)
  7. 2262388Species Human (Homo sapiens) [TaxId:9606] [111442] (2 PDB entries)
    Uniprot Q6H8Q1 73-140, 212-271
  8. 2262390Domain d1v6ga2: 1v6g A:42-75 [108397]
    Other proteins in same PDB: d1v6ga3, d1v6ga4
    Structural genomics target
    complexed with zn

Details for d1v6ga2

PDB Entry: 1v6g (more details)

PDB Description: solution structure of the lim domain of the human actin binding lim protein 2
PDB Compounds: (A:) Actin Binding LIM Protein 2

SCOPe Domain Sequences for d1v6ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v6ga2 g.39.1.3 (A:42-75) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]}
fvcavcrlpfppgdrvtfngkecmcqkcslpvsv

SCOPe Domain Coordinates for d1v6ga2:

Click to download the PDB-style file with coordinates for d1v6ga2.
(The format of our PDB-style files is described here.)

Timeline for d1v6ga2: