![]() | Class g: Small proteins [56992] (79 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (14 families) ![]() |
![]() | Family g.39.1.3: LIM domain [57736] (5 proteins) duplication: contains two (sub)domains of this fold |
![]() | Protein Actin-binding LIM protein 2, abLIM2 [111441] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [111442] (2 PDB entries) |
![]() | Domain d1v6ga2: 1v6g A:42-81 [108397] Structural genomics target complexed with zn |
PDB Entry: 1v6g (more details)
SCOP Domain Sequences for d1v6ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v6ga2 g.39.1.3 (A:42-81) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens)} fvcavcrlpfppgdrvtfngkecmcqkcslpvsvsgpssg
Timeline for d1v6ga2: