SCOP 1.71: Domain d1v6ga2: 1v6g A:42-81

Lineage for d1v6ga2 (1v6g A:42-81)

1. Root: SCOP 1.71

2. Class g: Small proteins [56992] (79 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (14 families)

5. Family g.39.1.3: LIM domain [57736] (5 proteins)
   duplication: contains two (sub)domains of this fold

6. Protein Actin-binding LIM protein 2, abLIM2 [111441] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [111442] (2 PDB entries)

8. Domain d1v6ga2: 1v6g A:42-81 [108397]
   Structural genomics target
   complexed with zn

Details for d1v6ga2

PDB Entry: 1v6g

PDB Description: solution structure of the lim domain of the human actin binding lim protein 2

SCOP Domain Sequences for d1v6ga2:

Sequence; same for both SEQRES and ATOM records:

>d1v6ga2 g.39.1.3 (A:42-81) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens)}
fvcavcrlpfppgdrvtfngkecmcqkcslpvsvsgpssg

Timeline for d1v6ga2:

• d1v6ga2 first appeared in SCOP 1.69
  
• d1v6ga2 appears in SCOP 1.73
  
• d1v6ga2 appears in the current release, SCOPe 2.08