Class g: Small proteins [56992] (98 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.3: LIM domain [57736] (18 proteins) duplication: contains two (sub)domains of this fold |
Protein Actin-binding LIM protein 2, abLIM2 [111441] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [111442] (2 PDB entries) Uniprot Q6H8Q1 73-140, 212-271 |
Domain d1v6ga1: 1v6g A:8-41 [108396] Other proteins in same PDB: d1v6ga3, d1v6ga4 Structural genomics target complexed with zn |
PDB Entry: 1v6g (more details)
SCOPe Domain Sequences for d1v6ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v6ga1 g.39.1.3 (A:8-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} ldyqrlygtrcfscdqfiegevvsalgktyhpdc
Timeline for d1v6ga1: