Lineage for d1v6ga1 (1v6g A:1-41)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 523848Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 523849Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (13 families) (S)
  5. 523936Family g.39.1.3: LIM domain [57736] (5 proteins)
    duplication: contains two (sub)domains of this fold
  6. 523937Protein Actin-binding LIM protein 2, abLIM2 [111441] (1 species)
  7. 523938Species Human (Homo sapiens) [TaxId:9606] [111442] (1 PDB entry)
  8. 523939Domain d1v6ga1: 1v6g A:1-41 [108396]

Details for d1v6ga1

PDB Entry: 1v6g (more details)

PDB Description: solution structure of the lim domain of the human actin binding lim protein 2

SCOP Domain Sequences for d1v6ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens)}
gssgssgldyqrlygtrcfscdqfiegevvsalgktyhpdc

SCOP Domain Coordinates for d1v6ga1:

Click to download the PDB-style file with coordinates for d1v6ga1.
(The format of our PDB-style files is described here.)

Timeline for d1v6ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v6ga2