Lineage for d1v65a1 (1v65 A:8-58)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2019672Fold a.212: KRAB domain (Kruppel-associated box) [109639] (1 superfamily)
    2 helices: one short, one long; aromatic-rich iterface
  4. 2019673Superfamily a.212.1: KRAB domain (Kruppel-associated box) [109640] (1 family) (S)
  5. 2019674Family a.212.1.1: KRAB domain (Kruppel-associated box) [109641] (1 protein)
    Pfam PF01352
  6. 2019675Protein hypotheical protein 2610044O15Rik [109642] (1 species)
  7. 2019676Species Mouse (Mus musculus) [TaxId:10090] [109643] (1 PDB entry)
    Uniprot Q8BG62 4-54
  8. 2019677Domain d1v65a1: 1v65 A:8-58 [108393]
    Other proteins in same PDB: d1v65a2, d1v65a3
    Structural genomics target

Details for d1v65a1

PDB Entry: 1v65 (more details)

PDB Description: solution structure of the kruppel-associated box (krab) domain
PDB Compounds: (A:) RIKEN cDNA 2610044O15

SCOPe Domain Sequences for d1v65a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v65a1 a.212.1.1 (A:8-58) hypotheical protein 2610044O15Rik {Mouse (Mus musculus) [TaxId: 10090]}
vtyddvhmnfteeewdlldssqkrlyeevmletyqnltdigynwqdhhiee

SCOPe Domain Coordinates for d1v65a1:

Click to download the PDB-style file with coordinates for d1v65a1.
(The format of our PDB-style files is described here.)

Timeline for d1v65a1: