Lineage for d1v65a_ (1v65 A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 450636Fold a.212: KRAB domain (Kruppel-associated box, Pfam 01352) [109639] (1 superfamily)
    2 helices: one short, one long; aromatic-rich iterface
  4. 450637Superfamily a.212.1: KRAB domain (Kruppel-associated box, Pfam 01352) [109640] (1 family) (S)
  5. 450638Family a.212.1.1: KRAB domain (Kruppel-associated box, Pfam 01352) [109641] (1 protein)
  6. 450639Protein hypotheical protein 2610044O15Rik [109642] (1 species)
  7. 450640Species Mouse (Mus musculus) [TaxId:10090] [109643] (1 PDB entry)
  8. 450641Domain d1v65a_: 1v65 A: [108393]
    Structural genomics target

Details for d1v65a_

PDB Entry: 1v65 (more details)

PDB Description: solution structure of the kruppel-associated box (krab) domain

SCOP Domain Sequences for d1v65a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v65a_ a.212.1.1 (A:) hypotheical protein 2610044O15Rik {Mouse (Mus musculus)}
gssgssgvtyddvhmnfteeewdlldssqkrlyeevmletyqnltdigynwqdhhieesg
pssg

SCOP Domain Coordinates for d1v65a_:

Click to download the PDB-style file with coordinates for d1v65a_.
(The format of our PDB-style files is described here.)

Timeline for d1v65a_: