SCOPe 2.07: Domain d1v63a1: 1v63 A:8-95

Lineage for d1v63a1 (1v63 A:8-95)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.21: HMG-box [47094] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.21.1: HMG-box [47095] (2 families)

5. Family a.21.1.1: HMG-box [47096] (10 proteins)

6. Protein Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) [68982] (2 species)
   Contains 6 HMG-box domains

7. Species Mouse (Mus musculus) [TaxId:10090] [109764] (3 PDB entries)
   Uniprot P25976 388-383, 392-470, 567-655

8. Domain d1v63a1: 1v63 A:8-95 [108391]
   Other proteins in same PDB: d1v63a2, d1v63a3
   Structural genomics target, HMG-box 5

Details for d1v63a1

PDB Entry: 1v63

PDB Description: solution structure of the 6th hmg box of mouse ubf1

PDB Compounds: (A:) Nucleolar transcription factor 1

SCOPe Domain Sequences for d1v63a1:

Sequence; same for both SEQRES and ATOM records:

>d1v63a1 a.21.1.1 (A:8-95) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]}
pkkppmngyqkfsqellsngelnhlplkermveigsrwqrisqsqkehykklaeeqqrqy
kvhldlwvkslspqdraaykeyisnkrk

Timeline for d1v63a1:

• d1v63a1 first appeared in SCOP 1.69, called d1v63a_
  
• d1v63a1 appears in SCOPe 2.06
  
• d1v63a1 appears in the current release, SCOPe 2.08