Lineage for d1v63a_ (1v63 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725579Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 1725580Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 1725581Family a.21.1.1: HMG-box [47096] (10 proteins)
  6. 1725613Protein Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) [68982] (2 species)
    Contains 6 HMG-box domains
  7. 1725618Species Mouse (Mus musculus) [TaxId:10090] [109764] (3 PDB entries)
    Uniprot P25976 388-383, 392-470, 567-655
  8. 1725621Domain d1v63a_: 1v63 A: [108391]
    Structural genomics target, HMG-box 5

Details for d1v63a_

PDB Entry: 1v63 (more details)

PDB Description: solution structure of the 6th hmg box of mouse ubf1
PDB Compounds: (A:) Nucleolar transcription factor 1

SCOPe Domain Sequences for d1v63a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgpkkppmngyqkfsqellsngelnhlplkermveigsrwqrisqsqkehykkla
eeqqrqykvhldlwvkslspqdraaykeyisnkrksgpssg

SCOPe Domain Coordinates for d1v63a_:

Click to download the PDB-style file with coordinates for d1v63a_.
(The format of our PDB-style files is described here.)

Timeline for d1v63a_: