SCOP 1.69: Domain d1v63a_: 1v63 A:

Lineage for d1v63a_ (1v63 A:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.21: HMG-box [47094] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.21.1: HMG-box [47095] (1 family)

5. Family a.21.1.1: HMG-box [47096] (9 proteins)

6. Protein Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) [68982] (2 species)
   Contains 6 HMG-box domains

7. Species Mouse (Mus musculus) [TaxId:10090] [109764] (2 PDB entries)

8. Domain d1v63a_: 1v63 A: [108391]
   Structural genomics target

Details for d1v63a_

PDB Entry: 1v63

PDB Description: solution structure of the 6th hmg box of mouse ubf1

SCOP Domain Sequences for d1v63a_:

Sequence; same for both SEQRES and ATOM records:

>d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus)}
gssgssgpkkppmngyqkfsqellsngelnhlplkermveigsrwqrisqsqkehykkla
eeqqrqykvhldlwvkslspqdraaykeyisnkrksgpssg

Timeline for d1v63a_:

• d1v63a_ is new in SCOP 1.69
  
• d1v63a_ appears in SCOP 1.71
  
• d1v63a_ appears in the current release, SCOPe 2.08, called d1v63a1