Lineage for d1v62a_ (1v62 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 462260Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 462261Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 462262Family b.36.1.1: PDZ domain [50157] (29 proteins)
    Pfam 00595
  6. 462289Protein Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) [110180] (1 species)
  7. 462290Species Human (Homo sapiens) [TaxId:9606] [110181] (1 PDB entry)
  8. 462291Domain d1v62a_: 1v62 A: [108390]
    Structural genomics target

Details for d1v62a_

PDB Entry: 1v62 (more details)

PDB Description: Solution structure of the 3rd PDZ domain of GRIP2

SCOP Domain Sequences for d1v62a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens)}
gssgssgdtvanasgplmveivktpgsalgisltttslrnksvitidrikpasvvdrsga
lhpgdhilsidgtsmehcslleatkllasisekvrleilpvpqsqrplrpssgpssg

SCOP Domain Coordinates for d1v62a_:

Click to download the PDB-style file with coordinates for d1v62a_.
(The format of our PDB-style files is described here.)

Timeline for d1v62a_: