Lineage for d1v61a_ (1v61 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 467364Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 467365Superfamily b.55.1: PH domain-like [50729] (9 families) (S)
  5. 467366Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (24 proteins)
  6. 467446Protein Rac/CDC42 GEF 6, alpha-pix [110262] (1 species)
  7. 467447Species Mouse (Mus musculus) [TaxId:10090] [110263] (1 PDB entry)
  8. 467448Domain d1v61a_: 1v61 A: [108389]
    Structural genomics target

Details for d1v61a_

PDB Entry: 1v61 (more details)

PDB Description: Solution Structure of the Pleckstrin Homology Domain of alpha-Pix

SCOP Domain Sequences for d1v61a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus)}
gssgssgqilsepiqawegddiktlgnvifmsqvvmqhgaceekeeryfllfssvlimls
asprmsgfmyqgkipiagmvvnrldeiegsdcmfeitgstverivvhcnnnqdfqewmeq
lnrltksgpssg

SCOP Domain Coordinates for d1v61a_:

Click to download the PDB-style file with coordinates for d1v61a_.
(The format of our PDB-style files is described here.)

Timeline for d1v61a_: