Lineage for d1v61a1 (1v61 A:8-126)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803067Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2803247Protein Rac/CDC42 GEF 6, alpha-pix [110262] (1 species)
  7. 2803248Species Mouse (Mus musculus) [TaxId:10090] [110263] (1 PDB entry)
    Uniprot Q8K4I3 429-551
  8. 2803249Domain d1v61a1: 1v61 A:8-126 [108389]
    Other proteins in same PDB: d1v61a2, d1v61a3
    Structural genomics target

Details for d1v61a1

PDB Entry: 1v61 (more details)

PDB Description: solution structure of the pleckstrin homology domain of alpha-pix
PDB Compounds: (A:) Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6

SCOPe Domain Sequences for d1v61a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v61a1 b.55.1.1 (A:8-126) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]}
qilsepiqawegddiktlgnvifmsqvvmqhgaceekeeryfllfssvlimlsasprmsg
fmyqgkipiagmvvnrldeiegsdcmfeitgstverivvhcnnnqdfqewmeqlnrltk

SCOPe Domain Coordinates for d1v61a1:

Click to download the PDB-style file with coordinates for d1v61a1.
(The format of our PDB-style files is described here.)

Timeline for d1v61a1: