Lineage for d1v5wa_ (1v5w A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2112131Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 protein domains)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2112544Protein Meiotic recombination protein DMC1/LIM15 homolog [110556] (1 species)
  7. 2112545Species Human (Homo sapiens) [TaxId:9606] [110557] (1 PDB entry)
    Uniprot Q14565
  8. 2112546Domain d1v5wa_: 1v5w A: [108387]

Details for d1v5wa_

PDB Entry: 1v5w (more details), 3.2 Å

PDB Description: Crystal structure of the human Dmc1 protein
PDB Compounds: (A:) Meiotic recombination protein DMC1/LIM15 homolog

SCOPe Domain Sequences for d1v5wa_:

Sequence, based on SEQRES records: (download)

>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]}
pgfltafeysekrkmvfhittgsqefdkllgggiesmaiteafgefrtgktqlshtlcvt
aqlpgaggypggkiifidtentfrpdrlrdiadrfnvdhdavldnvlyaraytsehqmel
ldyvaakfheeagifklliidsimalfrvdfsgrgelaerqqklaqmlsrlqkiseeynv
avfvtnqmtadpgatmtfqadpkkpigghilahasttrislrkgrgelriakiydspemp
eneatfaitaggigdake

Sequence, based on observed residues (ATOM records): (download)

>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]}
pgfltafeysekrkmvfhittgsqefdkllgggiesmaiteafgefrtgktqlshtlcvt
aqlpgaggypggkiifidtentfrpdrlrdiadrfnvdhdavldnvlyaraytsehqmel
ldyvaakfheeagifklliidsimalfrvdfsgrgelaerqqklaqmlsrlqkiseeynv
avfvtnqmghilahasttrislrkgrgelriakiydspempeneatfaitaggigdake

SCOPe Domain Coordinates for d1v5wa_:

Click to download the PDB-style file with coordinates for d1v5wa_.
(The format of our PDB-style files is described here.)

Timeline for d1v5wa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1v5wb_