Lineage for d1v5ua_ (1v5u A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 467364Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 467365Superfamily b.55.1: PH domain-like [50729] (9 families) (S)
  5. 467366Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (24 proteins)
  6. 467459Protein SET binding factor 1, Sbf1 [110260] (1 species)
  7. 467460Species Mouse (Mus musculus) [TaxId:10090] [110261] (1 PDB entry)
  8. 467461Domain d1v5ua_: 1v5u A: [108386]
    Structural genomics target

Details for d1v5ua_

PDB Entry: 1v5u (more details)

PDB Description: Solution Structure of the C-terminal Pleckstrin Homology Domain of Sbf1 from Mouse

SCOP Domain Sequences for d1v5ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus)}
gssgssgrsyegilykkgafmkpwkarwfvldktkhqlryydhrmdteckgvidlaevea
vapgtptigapktvdekaffdvkttrrvynfcaqdvpsaqqwvdriqsclssgpssg

SCOP Domain Coordinates for d1v5ua_:

Click to download the PDB-style file with coordinates for d1v5ua_.
(The format of our PDB-style files is described here.)

Timeline for d1v5ua_: